Geotalea uraniireducens: Gura_3612 Help Entry Gura_3612         CDS       T00521                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism gur  Geotalea uraniireducens Pathway gur01100   Metabolic pathways gur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gura_3612    00074 Mycolic acid biosynthesis     Gura_3612   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gura_3612 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABQ27766 UniProt:  A5G7J8 LinkDB All DBs Position complement(4235461..4235718) Genome browser AA seq 85 aa AA seqDB search MSEELINQVKQLIIDSLRIEGMSIADIDTDAPLFGEGLGLDSIDALQLVVGMEKAFGVVV ADAATGTKVFQSVRTMAAYIAEHRK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtctgaagaattgataaaccaggttaagcaactgatcatcgacagtctccgcattgag gggatgtcaatcgctgatatcgacaccgacgctccactttttggtgaagggttggggctt gattccatcgacgccctgcagctggtggtggggatggaaaaggcattcggcgtggtggtg gccgatgctgcgaccggtaccaaggttttccagtcggtcaggaccatggcggcttatatc gcggaacatcgtaaatga

DBGET integrated database retrieval system