Galeopterus variegatus (Sunda flying lemur): 103605247
Help
Entry
103605247 CDS
T08727
Symbol
NDUFV2
Name
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
KO
K03943
NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:
7.1.1.2
]
Organism
gvr
Galeopterus variegatus (Sunda flying lemur)
Pathway
gvr00190
Oxidative phosphorylation
gvr01100
Metabolic pathways
gvr04714
Thermogenesis
gvr04723
Retrograde endocannabinoid signaling
gvr04932
Non-alcoholic fatty liver disease
gvr05010
Alzheimer disease
gvr05012
Parkinson disease
gvr05014
Amyotrophic lateral sclerosis
gvr05016
Huntington disease
gvr05020
Prion disease
gvr05022
Pathways of neurodegeneration - multiple diseases
gvr05208
Chemical carcinogenesis - reactive oxygen species
gvr05415
Diabetic cardiomyopathy
Module
gvr_M00143
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:
gvr00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
103605247 (NDUFV2)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
103605247 (NDUFV2)
09159 Environmental adaptation
04714 Thermogenesis
103605247 (NDUFV2)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
103605247 (NDUFV2)
09164 Neurodegenerative disease
05010 Alzheimer disease
103605247 (NDUFV2)
05012 Parkinson disease
103605247 (NDUFV2)
05014 Amyotrophic lateral sclerosis
103605247 (NDUFV2)
05016 Huntington disease
103605247 (NDUFV2)
05020 Prion disease
103605247 (NDUFV2)
05022 Pathways of neurodegeneration - multiple diseases
103605247 (NDUFV2)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
103605247 (NDUFV2)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
103605247 (NDUFV2)
Enzymes [BR:
gvr01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
103605247 (NDUFV2)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
2Fe-2S_thioredx
DUF7443
Androglobin_II
Motif
Other DBs
NCBI-GeneID:
103605247
NCBI-ProteinID:
XP_008588049
UniProt:
A0ABM0S5A8
LinkDB
All DBs
Position
Unknown
AA seq
249 aa
AA seq
DB search
MFSSAALRARATGLTAQWGRHIRNLHKTVVHNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTPKDVEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
NT seq
750 nt
NT seq
+upstream
nt +downstream
nt
atgttttcctccgcggcgctccgggcccgggcgactggcctcaccgcccagtggggaaga
catataaggaatttgcataagacagttgtgcacaatggagctggaggagccttatttgtg
cacagagatactcctgagaataacccagacactccatttgatttcacaccagaaaactat
aagaggatagaggcaattgtaaaaaactatccagaagggcataaagcagcagctgtgctt
ccagtcctggatttagcccaaaggcagaatgggtggttgcctatctctgctatgaacaag
gttgcagaagttttacaagtacctccaatgagagtatatgaagtagcaactttttataca
atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccctgc
atgcttcgaaactctgacagcatactagaagccattcagaaaaagcttggaataaaggtt
ggggagaccacacctgacaaacttttcactcttatagaggtggaatgtttaggggcctgt
gtaaatgcaccaatggttcaaataaatgacaactactatgaggatctgacacctaaggat
gttgaagaaatcattgatgagcttaaggctggcaaaattccaaaacctgggccaaggagt
ggacgcttctcttgtgagccagctggaggtcttacctcattgacagaaccacccaaagga
cctggctttggtgtgcaagcaggcctttaa
DBGET
integrated database retrieval system