Entry |
|
Symbol |
ND4L, KEF87_p05
|
Name |
(RefSeq) NADH dehydrogenase subunit 4L
|
KO |
|
Organism |
gvr Galeopterus variegatus (Sunda flying lemur)
|
Pathway |
gvr04723 | Retrograde endocannabinoid signaling |
gvr05022 | Pathways of neurodegeneration - multiple diseases |
gvr05208 | Chemical carcinogenesis - reactive oxygen species |
|
Module |
gvr_M00142 | NADH:ubiquinone oxidoreductase, mitochondria |
|
Brite |
KEGG Orthology (KO) [BR:gvr00001]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
804972 (ND4L)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
804972 (ND4L)
09159 Environmental adaptation
04714 Thermogenesis
804972 (ND4L)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
804972 (ND4L)
09164 Neurodegenerative disease
05010 Alzheimer disease
804972 (ND4L)
05012 Parkinson disease
804972 (ND4L)
05014 Amyotrophic lateral sclerosis
804972 (ND4L)
05016 Huntington disease
804972 (ND4L)
05020 Prion disease
804972 (ND4L)
05022 Pathways of neurodegeneration - multiple diseases
804972 (ND4L)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
804972 (ND4L)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03029 Mitochondrial biogenesis [BR:gvr03029]
804972 (ND4L)
Enzymes [BR:gvr01000]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
804972 (ND4L)
Mitochondrial biogenesis [BR:gvr03029]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial DNA-encoded proteins
Mitochondrial respiratory chain complex I
804972 (ND4L)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
AA seq |
98 aa
MPPIYINIILAYTASLVGLLMYRSHFMSSLLCLEGMMLSLFILATILSLNLHFTLSFTLP
IILLIFAGCETAVGLALLVMISDIYGLDHVQNLNLLQC |
NT seq |
297 nt +upstreamnt +downstreamnt
atgcccccaatctacattaacattattctagcatataccgcatcccttgtgggattatta
atataccggtctcacttcatatcctcactattatgcttggagggcataatactatcccta
ttcattctggccactatcctatccctaaacctacacttcaccctgtccttcaccctccct
attattctcttaattttcgcgggatgcgagaccgctgtaggcctagcactcttagtaata
atctccgacatctacggcctggaccatgtacagaaccttaatctcctacaatgctaa |