Geobacillus sp. WCH70: GWCH70_1082 Help Entry GWCH70_1082       CDS       T00915                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gwc  Geobacillus sp. WCH70 Pathway gwc01100   Metabolic pathways gwc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gwc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GWCH70_1082    00074 Mycolic acid biosynthesis     GWCH70_1082   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GWCH70_1082 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 PP-binding_2 SAPS Motif Other DBs NCBI-ProteinID:  ACS23942 UniProt:  C5D8T5 LinkDB All DBs Position 1135178..1135414 Genome browser AA seq 78 aa AA seqDB search MVADVLERVTKIIVDRLGVEESQVTLDASFKDDLGADSLDIVELVMELEDEFNMEISDEE AEKIVTVGDAVNYIKSHM NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtggtggcagacgtgttagagcgtgttacgaaaattatcgtcgaccgcttgggtgtcgaa gaatcccaagttacattggatgcttctttcaaagatgatctaggggcagactctctagat atcgtagagcttgtgatggaattagaagatgaatttaatatggaaatttctgatgaagag gctgaaaaaattgtcacagtaggagatgctgtgaactacataaaaagccacatgtaa

DBGET integrated database retrieval system