Geobacillus sp. WCH70: GWCH70_1546 Help Entry GWCH70_1546       CDS       T00915                                  Name (GenBank) cobalt transport protein   KO K02009   cobalt/nickel transport protein Organism gwc  Geobacillus sp. WCH70 Pathway gwc02010   ABC transporters Brite KEGG Orthology (KO) [BR:gwc00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     GWCH70_1546  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:gwc02000]     GWCH70_1546 Transporters [BR:gwc02000]  ABC transporters, prokaryotic type   Metallic cation, iron-siderophore and vitamin B12 transporters    Cobalt transporter     GWCH70_1546    Nickel transporter     GWCH70_1546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CbiN Motif Other DBs NCBI-ProteinID:  ACS24344 UniProt:  C5DAN0 LinkDB All DBs Position 1622606..1622890 Genome browser AA seq 94 aa AA seqDB search MKRSLFLLAIAVLLVVAPLLFIHHSDFGGTDGQAEKMIQKLAPHYQPWMETIFEPPGGEV ETLLFSVQAAIGAGIIGYIIGVYKGRANRKEEAK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagagaagtctttttcttcttgctattgctgttttactggtagtagcgccgttattg ttcattcatcactctgattttggcggcacggatggccaggcggaaaaaatgattcagaag ctcgctcctcattatcaaccttggatggaaaccatatttgagccgccaggcggagaggtg gaaacgttgctgttttctgtgcaggcggcaatcggtgccggaattattggctatattatc ggcgtctataaaggccgggcgaaccgaaaagaggaagcaaaatga

DBGET integrated database retrieval system