Komagataeibacter xylinus: H845_906 Help Entry H845_906          CDS       T03044                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gxl  Komagataeibacter xylinus Pathway gxl01100   Metabolic pathways gxl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gxl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H845_906    00074 Mycolic acid biosynthesis     H845_906   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H845_906 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  AHI24857 LinkDB All DBs Position 980249..980488 Genome browser AA seq 79 aa AA seqDB search MSEIADKVKKIVVEHLGVDESKVTPDASFIDDLGADSLDTVELVMAFEEAFSVEIPEDAA EKITTVKDAIDYIEKQKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaatcgccgataaggttaagaagatcgtagtcgagcaccttggtgtggacgaa agcaaggtcacccccgatgcctcgttcatcgatgatctgggcgccgacagcctggacacg gttgaactggtcatggcgttcgaggaagcgttcagcgtcgagatccccgaagacgccgcc gagaagatcacgaccgtaaaggacgcgatcgactatatcgagaagcagaaagctgcctga

DBGET integrated database retrieval system