Komagataeibacter medellinensis: GLX_24770 Help Entry GLX_24770         CDS       T01631                                  Name (GenBank) cell division inhibitor   KO K03608   cell division topological specificity factor Organism gxy  Komagataeibacter medellinensis Brite KEGG Orthology (KO) [BR:gxy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gxy03036]     GLX_24770   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:gxy04812]     GLX_24770 Chromosome and associated proteins [BR:gxy03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     GLX_24770 Cytoskeleton proteins [BR:gxy04812]  Prokaryotic cytoskeleton proteins   MinD / ParA class of bacterial cytoskeletal proteins    GLX_24770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MinE Motif Other DBs NCBI-ProteinID:  BAK84889 UniProt:  G2I1V3 LinkDB All DBs Position complement(2736500..2736778) Genome browser AA seq 92 aa AA seqDB search MGLFDSFFGRSTKTSAPVARDRLQILLAHERTGNDGDESDLLNKLHAEILEVIKRHIPVD QDKVQVKLDRGNSVSMLEIDIEVPQIKSPGHR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgggcctgttcgactcttttttcgggcgcagcacgaaaacatccgcacctgtggcccgc gatcgcctgcagattttgctggcgcacgagcgcacgggcaacgacggagatgaatccgac ctgcttaacaagttacatgccgaaatcctcgaagtgatcaagcggcacattcccgttgat caggacaaggtgcaggtcaagctggaccggggcaattccgtctcgatgcttgagatcgac atcgaggtgccgcagatcaagtcccccggccaccgctag

DBGET integrated database retrieval system