KEGG   Geobacillus sp. Y412MC52: GYMC52_2157
Entry
GYMC52_2157       CDS       T01399                                 
Name
(GenBank) DnaQ family exonuclease/DinG family helicase
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
gya  Geobacillus sp. Y412MC52
Brite
KEGG Orthology (KO) [BR:gya00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gya03400]
    GYMC52_2157
Enzymes [BR:gya01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     GYMC52_2157
DNA repair and recombination proteins [BR:gya03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    GYMC52_2157
SSDB
Motif
Pfam: Helicase_C_2 RNase_T DEAD ResIII RNase_H_2 DEDDh_C Helicase_C NTP_transf_3 DNA_pol_A_exo1 SNF2-rel_dom
Other DBs
NCBI-ProteinID: ADU94559
LinkDB
Position
complement(2232320..2235049)
AA seq 909 aa
MATRFVIIDLETTGNGPKKGDRIIQLGMAVVEDGLIVERFASFFNPEQPIPLFIQQLTNI
NEQMVEGAPLFADKAGEIAALMHGAYFVAHNVDFDLPFLQAELERAGWPPFAGPTIDTVE
LARIVLPTAESYKLGDLARQLGLRHDRPHQADSDAEVTAKLFIALLKRLSRLPLMTLEQL
RGLARHLKSDIYLLLDAVIAKKRNKAPADRTVAVYRGIALKQPAPEPDESDRRPALASFA
AFCEQEPPLPLPGYKRRAGQWEMMRLVYEALSTSQHALIEAGTGLGKSLAYLIPAAFFAC
EQQERVVISTHTLQLQEQLIRRDWPVLRQIAPFPLRVAVLKGKQNYLSLDKFASFLSEPS
DTYDAALLKCQVLVWLLETDSGDLDELNVSSGARLLLSALAIGEEEDGGRHHFFARAKER
SERADVVITNHALLLHDLTGPAPLLPPFRHLIIDEAHRLEDAAARCFGEQIGYVSFRLLT
AKIVQTIAKWQEAEQDAPNGALVRCQQRLEELQFEGDELFRLLRRYALDKKPARAGRCRY
RFSPTDEQSRAWQAAVELCWRLRHLAAALSAEAKPLLSADTSGDFPPSALLSADLAALNR
QMAALVRLLTEKEPGVVRWIEADEKGAANAVRLYSQPVDLADFFADQLFMKKRSVVLTSA
TLTVRGRFTYMAARLGLEDFYPLCRSFPPPFRYEEQAALFVPADMPLVSAVPLEDYAEAV
AASVLAIARRLGRRVLVLFPSYELLKLTVDALKTEEEGEPFVLIAQGVQSGSPAKLLRTF
LQFEHAVLFGTSSFWEGVDLPGSALDVLVIARLPFAPPDDPVMEAKSERIRLEGGDPFSE
LALPEAVLRFKQGFGRLIRTEDDKGAVFVLDRRLMASPYGADFLASLPPLSVHEGALSEL
LDKAETWLS
NT seq 2730 nt   +upstreamnt  +downstreamnt
atggcaacgcgctttgtcatcattgacttggagacaaccggaaatgggccgaaaaaaggc
gatcggatcatccagctcggcatggcggtcgtcgaagatggcctgattgtcgaacggttt
gccagcttttttaacccggaacagcccattccgctgttcattcagcagctgacgaacatc
aacgaacagatggtcgaaggagcgccgctgtttgctgacaaggcgggcgagatcgccgcc
ttgatgcacggtgcttactttgtcgcccataacgtcgactttgatttgccgtttttgcag
gccgagcttgaacgggctggctggccgccgtttgccggtccgacgatcgatacggtcgag
ctcgcccgcatcgtgttgccgactgccgaaagctataagctcggcgatttggcgaggcag
ctcggcctccgccacgatcgtccgcatcaagcggacagcgatgcggaagtgaccgccaag
ctgttcattgccttgctcaagcggctctcccgtctgccgcttatgacgcttgagcaactg
cgcggtcttgcccgccacttgaaaagcgatatttacttgctccttgatgcggtcatcgcc
aaaaagcggaacaaggcgccggccgaccgcactgtcgccgtataccgcggcattgcgttg
aaacaaccggcgccggagccagatgagagcgatcggcgccccgctttggcttcgttcgct
gccttttgcgaacaggagccgccccttccgcttcccggctacaagcggcgcgcggggcag
tgggagatgatgcggctcgtttatgaggcgctgtcgacgtcccagcacgcgctcattgaa
gcagggaccggacttggcaaatcgctcgcctatttgattcccgctgctttttttgcctgt
gagcagcaagagcgggtcgtcatcagcacgcataccctccagctgcaggagcagctcatt
cgccgcgattggccggtattgcggcaaatcgcgccgtttccgctccgcgttgccgttttg
aaaggaaagcaaaattacttatcccttgacaagttcgcttcgtttttgtcggagccgtct
gacacgtacgatgcggcgctcttgaaatgccaggtgctcgtttggctgcttgagaccgac
agcggcgacttggacgaattgaatgtgtcatccggcgcccgtctcctattgtccgcgctt
gccatcggcgaagaggaagacggcgggcggcatcattttttcgcccgggcgaaagagcgc
tccgaacgggcggatgtggtcattaccaaccatgcgcttttgcttcatgatttgaccggc
ccggcgccgcttttgccgccgtttcgccatctgatcatcgatgaggcgcatcggcttgaa
gatgccgccgcccggtgttttggcgagcagattggctatgtgtcgtttcgcctgctgacc
gccaaaatcgtgcagacgatcgcgaaatggcaagaagcagaacaggacgcaccgaatggg
gctcttgtccgttgccagcagcgccttgaggagctgcagtttgaaggggacgagctgttc
cgcctgttgcgccgctatgcgttggacaaaaagccagctcgcgctggacgttgccgctat
cgcttttcgccgacggacgaacagagccgggcgtggcaggcggcggtggagttatgctgg
cgcctgcgccatttggcggcggcgctatccgctgaagcgaagccgcttctatccgctgat
acgagtggcgatttcccaccatccgccttgctgtcggctgatttggcggctctcaaccgg
caaatggctgcgcttgtgcgtttgctgaccgaaaaggagccgggtgtcgtccggtggatc
gaagcggacgaaaaaggggcggcgaacgctgtccgcctttactcgcagccggttgacctt
gctgactttttcgccgatcaactgtttatgaaaaaacggagcgtcgttttgacgtccgcg
acgctcacggtccgcggccggttcacgtatatggcggcgcgtctcggtcttgaggatttt
tatccactttgccgctcgtttccgccgccgtttcgttacgaggagcaggccgcgctcttc
gtgccggcggacatgccgctcgtttctgccgtgccgcttgaagattacgccgaagcggtc
gccgcttcggtgcttgcgatcgcccgacgcctcggacggcgggtgcttgtgttgttccct
tcgtatgaactgttgaaactgacggttgatgcgttgaagacggaggaagaaggcgagccg
tttgttttgatcgctcaaggggtgcaaagcggcagtccggcaaagctcttgcggacgttt
ttgcagtttgagcatgcggtgttgtttgggacgagcagcttttgggaaggggtcgatctg
ccaggttcagcgctcgatgtgcttgtcatcgcccgcttgccgtttgcgcccccggacgat
cccgtgatggaggcaaaaagcgagcgcattcgcctagaaggcggcgatccgttttccgag
ctggcgcttcctgaggcggtgcttcgttttaagcaagggtttggccgcctcattcgcact
gaagacgacaaaggagccgtatttgtgctggatcggcggctgatggcttccccgtacggc
gcggattttctcgcttccttgccgccgctttcggtgcatgaaggcgcgctttctgagctg
ctcgacaaggcggaaacttggctttcttaa

DBGET integrated database retrieval system