Halotalea alkalilenta: A5892_05870 Help Entry A5892_05870       CDS       T04333                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism haa  Halotalea alkalilenta Pathway haa01100   Metabolic pathways haa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A5892_05870    00074 Mycolic acid biosynthesis     A5892_05870   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A5892_05870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANF57051 UniProt:  A0A172YCR7 LinkDB All DBs Position complement(1339590..1339859) Genome browser AA seq 89 aa AA seqDB search MTHTPNLSLELKRLIIDTLELEDITPEDIDDAAPLFVDGLGLDSIDALELGLALQKRYGI RLDAEQDDIHRHFASIDALAALVSERHVD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgacgcatacgcctaacctgtccctcgagctcaagcgtctgatcatcgacacgctcgag ctcgaggacatcaccccggaggacatcgacgatgccgcaccgctgttcgtcgacggactg ggactcgactcgatcgacgcgctcgagctcggtctcgcgctgcaaaagcgctacggtatc cgtctcgatgcggagcaggacgacatccaccgccacttcgccagcatcgatgctctggcc gcattggtgagcgaacgccatgtcgactga

DBGET integrated database retrieval system