Halotalea alkalilenta: A5892_13235 Help Entry A5892_13235       CDS       T04333                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism haa  Halotalea alkalilenta Brite KEGG Orthology (KO) [BR:haa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:haa03036]     A5892_13235    03400 DNA repair and recombination proteins [BR:haa03400]     A5892_13235 Chromosome and associated proteins [BR:haa03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     A5892_13235 DNA repair and recombination proteins [BR:haa03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       A5892_13235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS_N PFam54_60 DUF6779 Allexi_40kDa Tugs DUF5955 TENA_THI-4 Motif Other DBs NCBI-ProteinID:  ANF58315 UniProt:  A0A172YH67 LinkDB All DBs Position complement(2962349..2962621) Genome browser AA seq 90 aa AA seqDB search MSVLERLAGNKNVARGALRQLSLAELEKLATIFDEIRQEKAEEQHALDAAVDEKKKQLAA IRAQLEALGISPEELKPAKRRPGRPRKSSL NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtctgtattggaaaggctggcgggcaacaagaacgtggcgcgcggcgcgctgcgccag ctgtcgctcgctgagcttgagaagctggccacgatcttcgacgaaattcgccaagaaaag gctgaagagcagcatgcgttggatgccgccgtggatgagaagaaaaagcagctggccgct attcgggctcagttggaggcgctgggtatttcccctgaggagttgaagccagccaaacgg cggccaggtcgtcctcgcaagagttcgttatag

DBGET integrated database retrieval system