KEGG   Halocatena salina: MW046_01555
Entry
MW046_01555       CDS       T08090                                 
Name
(GenBank) hypothetical protein
  KO
K00339  NADH-quinone oxidoreductase subunit J [EC:7.1.1.2]
Organism
haad  Halocatena salina
Pathway
haad00190  Oxidative phosphorylation
haad01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:haad00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MW046_01555
Enzymes [BR:haad01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     MW046_01555
SSDB
Motif
Pfam: Oxidored_q3 DUF6479 DUF1774
Other DBs
NCBI-ProteinID: UPM43147
UniProt: A0A8U0A5F9
LinkDB
Position
complement(304959..305315)
AA seq 118 aa
MTTRPRLYLGRHLLSGLAAVALFVVMAAAFLSAQFPPVQGFESGSVTASIGYALFDLSGP
IASEYFLVAFEVMGVLLVAALTGAVMLARRESDSDSASDVSSRDVRTDGGTASTEDRR
NT seq 357 nt   +upstreamnt  +downstreamnt
atgacgactcgaccacggttgtatctcggtcgacacctcctgtcgggattggcggcagtt
gcgttgtttgtcgttatggcagcggcgtttctgtcggctcaatttccaccggtacagggg
ttcgaatcgggatcagtcaccgcaagcatcgggtacgcgctgttcgatctgagcggcccg
atagcctcggagtatttccttgtcgcgttcgaggttatgggcgttctcctcgtggctgcg
ctcacgggagccgtgatgcttgcgcgacgggagagtgattccgactccgcttccgatgtt
tcgtcgagagacgttcgtactgacggtggcaccgcgtccacggaggaccgacgatga

DBGET integrated database retrieval system