Haloarcula sp. CBA1115: SG26_06975 Help Entry SG26_06975        CDS       T03645                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hab  Haloarcula sp. CBA1115 Pathway hab03010   Ribosome Brite KEGG Orthology (KO) [BR:hab00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SG26_06975   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SG26_06975  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hab03011]     SG26_06975    04121 Ubiquitin system [BR:hab04121]     SG26_06975   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hab04147]     SG26_06975 Ribosome [BR:hab03011]  Ribosomal proteins   Eukaryotes    Small subunit     SG26_06975   Archaea     SG26_06975 Ubiquitin system [BR:hab04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SG26_06975 Exosome [BR:hab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SG26_06975   Exosomal proteins of colorectal cancer cells    SG26_06975 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Ribosomal_L37e Zn_ribbon_GTF2H2 FYVE Cas12f1-like_TNB Zn_ribbon_RPB9 DZR DUF8054_C DZR_2 CHP02642 Auto_anti-p27 Zn_ribbon_RPAB4 zf_UBZ Zn_ribbon_3 zf-C2H2_FBX41 HypA Zn-ribbon_GIR1 EDR4-like_1st Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  AJF25487 LinkDB All DBs Position 1402534..1402668 Genome browser AA seq 44 aa AA seqDB search MPHNEYYSDDGELDRETCPRCGDTVLAEHEDRQHCGKCGYTEWK NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgccacacaacgagtactacagcgacgacggcgaactcgaccgcgagacctgtccccgg tgcggtgacaccgtcctcgccgagcacgaggaccgccagcactgcggcaagtgcggctac accgagtggaagtaa

DBGET integrated database retrieval system