Haloarcula sp. CBA1115: SG26_11700 Help Entry SG26_11700        CDS       T03645                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hab  Haloarcula sp. CBA1115 Pathway hab00280   Valine, leucine and isoleucine degradation hab00630   Glyoxylate and dicarboxylate metabolism hab00640   Propanoate metabolism hab01100   Metabolic pathways hab01110   Biosynthesis of secondary metabolites hab01120   Microbial metabolism in diverse environments hab01200   Carbon metabolism Module hab_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hab00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     SG26_11700    00640 Propanoate metabolism     SG26_11700   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     SG26_11700 Enzymes [BR:hab01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      SG26_11700     6.4.1.3  propionyl-CoA carboxylase      SG26_11700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF8022 Motif Other DBs NCBI-ProteinID:  AJF26345 LinkDB All DBs Position complement(2330592..2330897) Genome browser AA seq 101 aa AA seqDB search MAADTDSAVDADLVAEIAAQLDDASTAEAAAIAVAIGAHLTDRQRAAAAAAAAAAADDGD SWDGRQWSFSGRVEATQKRSVRVRSDAPTDPWSAAGRAERF NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcggctgacactgactcggctgtcgatgcagacctggtcgcagaaatcgccgcccaa ctcgacgacgcgtcgacggccgaagcggctgctatcgccgtcgctatcggcgcacacctc accgaccgccagcgtgcggcagcagcggccgcggcggctgcggcggcagacgacggtgac tcctgggacggcagacagtggtcgttctccgggcgcgttgaagccacgcagaagcggtcc gttcgggttcgctcggacgcgccgaccgacccctggagcgctgccggccgcgccgaacgg ttctaa

DBGET integrated database retrieval system