Halorhabdus sp. BNX81: HBNXHr_0295 Help Entry HBNXHr_0295       CDS       T09448                                  Symbol rpl40a Name (GenBank) Ribosomal protein L40E   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism habn  Halorhabdus sp. BNX81 Pathway habn03010   Ribosome Brite KEGG Orthology (KO) [BR:habn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HBNXHr_0295 (rpl40a)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HBNXHr_0295 (rpl40a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:habn03011]     HBNXHr_0295 (rpl40a)    04121 Ubiquitin system [BR:habn04121]     HBNXHr_0295 (rpl40a) Ribosome [BR:habn03011]  Ribosomal proteins   Eukaryotes    Large subunit     HBNXHr_0295 (rpl40a)   Archaea     HBNXHr_0295 (rpl40a) Ubiquitin system [BR:habn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HBNXHr_0295 (rpl40a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DHHC Zf_1st_IFT121 Motif Other DBs NCBI-ProteinID:  WEL20372 LinkDB All DBs Position 307843..307992 Genome browser AA seq 49 aa AA seqDB search MAQFDKAEGRTLDKQICMRCNARNPERADQCRKCGYGNLRPKAKEPRNA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggctcaattcgacaaagcggaggggcgaaccctcgacaagcagatctgcatgcgctgt aacgcccgcaaccccgagcgcgccgaccaatgccggaagtgtggctacggcaaccttcgc ccgaaagccaaggaaccccgcaacgcctaa

DBGET integrated database retrieval system