Halorhabdus sp. BNX81: HBNXHr_2552 Help Entry HBNXHr_2552       CDS       T09448                                  Symbol rps27AE Name (GenBank) Ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism habn  Halorhabdus sp. BNX81 Pathway habn03010   Ribosome Brite KEGG Orthology (KO) [BR:habn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HBNXHr_2552 (rps27AE)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HBNXHr_2552 (rps27AE)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:habn03011]     HBNXHr_2552 (rps27AE)    04121 Ubiquitin system [BR:habn04121]     HBNXHr_2552 (rps27AE)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:habn04147]     HBNXHr_2552 (rps27AE) Ribosome [BR:habn03011]  Ribosomal proteins   Eukaryotes    Small subunit     HBNXHr_2552 (rps27AE)   Archaea     HBNXHr_2552 (rps27AE) Ubiquitin system [BR:habn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HBNXHr_2552 (rps27AE) Exosome [BR:habn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HBNXHr_2552 (rps27AE)   Exosomal proteins of colorectal cancer cells    HBNXHr_2552 (rps27AE) SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 zf-Tbcl_FmdE DZR_2 Zn_ribbon_19 zf_Tbcl_5 Motif Other DBs NCBI-ProteinID:  WEL22594 LinkDB All DBs Position 2532979..2533113 Genome browser AA seq 44 aa AA seqDB search MARHELYNDDGTTDRELCPRCGDAFLADHGDRTHCGRCSYTEWN NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgtcacgaactctacaacgacgacggaaccaccgaccgtgaactgtgcccgcgg tgtggcgacgcgttcctcgccgaccacggcgaccgcacgcattgcggtcggtgtagctac accgagtggaactga

DBGET integrated database retrieval system