Halobacterium sp. BOL4-2: JRZ79_05965 Help Entry JRZ79_05965       CDS       T07284                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism habo  Halobacterium sp. BOL4-2 Pathway habo00280   Valine, leucine and isoleucine degradation habo00630   Glyoxylate and dicarboxylate metabolism habo00640   Propanoate metabolism habo01100   Metabolic pathways habo01110   Biosynthesis of secondary metabolites habo01120   Microbial metabolism in diverse environments habo01200   Carbon metabolism Module habo_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:habo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     JRZ79_05965    00640 Propanoate metabolism     JRZ79_05965   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     JRZ79_05965 Enzymes [BR:habo01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      JRZ79_05965     6.4.1.3  propionyl-CoA carboxylase      JRZ79_05965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HD-CE Motif Other DBs NCBI-ProteinID:  QRY23965 UniProt:  A0A895A5V8 LinkDB All DBs Position 1105546..1105803 Genome browser AA seq 85 aa AA seqDB search MPAEMDLTIPEDASEEEAAAIAAAVQSHLAAMAAAAAAADDNEATWPGEKWRFAGRVERQ GGRSVRVPDGAPTDAWSAAGRRDRF NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccgccgagatggacctgacgatccccgaggacgccagcgaggaggaggcggccgcc atcgctgcggccgtccagagccacctggccgcgatggcggcggccgcggcggccgccgac gacaacgaggcgacgtggcccggtgagaaatggcggttcgccggccgcgtcgaacgacag ggcgggcgctcggtgcgcgtgcccgacggtgcgcccaccgacgcgtggagcgcggcgggg cgtcgcgaccggttttag

DBGET integrated database retrieval system