Halobacterium sp. BOL4-2: JRZ79_08060 Help Entry JRZ79_08060       CDS       T07284                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism habo  Halobacterium sp. BOL4-2 Pathway habo03010   Ribosome Brite KEGG Orthology (KO) [BR:habo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     JRZ79_08060   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     JRZ79_08060  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:habo03011]     JRZ79_08060    04121 Ubiquitin system [BR:habo04121]     JRZ79_08060 Ribosome [BR:habo03011]  Ribosomal proteins   Eukaryotes    Large subunit     JRZ79_08060   Archaea     JRZ79_08060 Ubiquitin system [BR:habo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    JRZ79_08060 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Zn_Ribbon_1 Ribosomal_L40e DZR DZR_2 HVO_0416 DUF6395 Zn_ribbon_3 Zn_ribbon_RPAB4 UPF0547 Zn_ribbon_ZPR1 Zn_ribbon_RPB9 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  QRY24359 LinkDB All DBs Position 1507626..1507769 Genome browser AA seq 47 aa AA seqDB search MSETIEDRLLNKQVCMRCNARNPTDAESCRKCGYKNLRTKASERRSA NT seq 144 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccattgaggaccgactgctgaacaagcaggtctgcatgcggtgtaacgca cggaacccgacggacgccgagagctgccggaagtgcgggtacaagaacctccgcacgaag gcctccgagcgtcgctccgcgtaa

DBGET integrated database retrieval system