KEGG   Helicobacter acinonychis: Hac_1432
Entry
Hac_1432          CDS       T00371                                 
Name
(GenBank) predicted neuraminidase (sialidase)
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hac  Helicobacter acinonychis
Pathway
hac00540  Lipopolysaccharide biosynthesis
hac01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hac00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Hac_1432
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hac01005]
    Hac_1432
Lipopolysaccharide biosynthesis proteins [BR:hac01005]
 Lipid A
  Hac_1432
SSDB
Motif
Pfam: BNR_2
Other DBs
NCBI-ProteinID: CAK00160
UniProt: Q17W16
LinkDB
Position
1242411..1243454
AA seq 347 aa
MTRQTPPYAFTHNQALLTENPPYFTQLIIPKPHDALSVHASTLISLSNNNLLSAYFSGTK
EGARDVKISANLFDGKTNRWSEAFTLLTKEELSKNAHEYIKKLGNPLLFLHNDKILLFVV
GVSMGGWATSKIYQFESALEPIDFKFVQKLSLSPFLNLSHLVRTKPLNTTDGGFVLPLYH
ELATQYPLLLKFDKHHNPRELLRPNALNHQLQPSLTPFKDCAIMTFRNHFFKDYLMLETC
KHPTTWQKPMPTNLKNLNDALNLLNLNGSLYLIHNPSDLFLRRKELLLSKLENANSFQTL
KILDKANEVSYPSSSLNSHFIDIVYTYNRSNIKHIRFNMAYLNSLPK
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgacgcgccaaacccccccctacgctttcacgcacaatcaagcccttttaactgaaaac
cccccctattttactcaacttattatccctaaaccccatgacgctttaagcgtgcatgca
agcactctcattagcctatctaataacaatctcttgagcgcttattttagcggcactaaa
gaaggggcaagggatgtgaaaatcagcgccaatctttttgatggcaagaccaatcgttgg
agcgaagctttcactcttttaaccaaagaagaactttccaaaaacgcgcatgaatatatc
aaaaaattgggtaaccccttgcttttcttgcataacgataaaattttgttgtttgtcgta
ggggtgagcatgggtgggtgggcgacttctaaaatctatcaatttgaaagcgctttagag
ccgattgatttcaaatttgtgcaaaaactctctttaagcccttttttaaatttgagccat
ttagtaaggactaaacccttaaacaccactgatggtggttttgtgttgccactctatcac
gaattagccacgcaataccctttgttattgaaatttgacaaacaccataaccctagagag
cttttaaggccaaacgctttaaaccaccagctccaaccaagcctaaccccctttaaagac
tgcgctatcatgacgtttagaaaccatttttttaaagattatctcatgctagaaacttgc
aaacaccccaccacttggcaaaaacccatgcccacgaatttgaaaaatttgaacgacgct
ttgaatttactcaatttgaatggatcgttatatttaatccataaccctagcgatttattc
ttacggcgtaaagaactcctactttctaaattagaaaatgcaaactcgtttcaaacctta
aaaattttggataaagccaatgaggtgagttacccaagctctagccttaattctcatttc
atagatattgtctatacttataaccgctctaatatcaaacacatccgtttcaatatggct
tatttaaattcccttcccaagtaa

DBGET integrated database retrieval system