KEGG   Halobaculum sp. CBA1158: Hbl1158_02450
Entry
Hbl1158_02450     CDS       T08013                                 
Name
(GenBank) ABC transporter ATP-binding protein
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
hacb  Halobaculum sp. CBA1158
Pathway
hacb02010  ABC transporters
hacb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:hacb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Hbl1158_02450
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Hbl1158_02450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hacb02000]
    Hbl1158_02450
Transporters [BR:hacb02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter
    Hbl1158_02450
SSDB
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 AAA_23 AAA_29 ABC_ATPase RsgA_GTPase MMR_HSR1 SMC_N AAA_16 TubZ_C_3 AAA_27 AAA_22 AAA_30 GTP_EFTU Zeta_toxin Dynamin_N AAA_15
Other DBs
NCBI-ProteinID: UIP00251
LinkDB
Position
489499..490257
AA seq 252 aa
MTLLQTDGLTKQFGGLVAVDDVSFEVESGETRAVIGPNGAGKSTLINCITGALEPTAGRV
EFDGEDITDLEPHETVQAGVSKSFQTASIFPSMTVRENVEIAAVAAAHGSFSVDFLKRLA
GFDEVHDITDRMLDSVDLLGDAEMEAASLPYGDKRRLEIAIALASEPDLLLMDEPTAGMS
PDETAATVDLVEQLQEDLGLTILIVEHDMEIIFQIADRILVLNRGQVIADGTPEQVQESE
EVQEAYLGGVEL
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaccctcctgcagaccgacgggctcacgaagcagttcggcggcctcgtcgccgtcgac
gacgtgagcttcgaggtcgaatcgggcgagacgcgcgcggtcatcgggcccaacggggcc
ggcaagtcgacgctcatcaactgcatcacgggcgcgctcgaacccaccgccggcagggtg
gagttcgacggcgaggacatcacggacctcgagccccacgagacggtgcaggccggcgtc
tccaagtcgttccagacggcgtcgatcttcccgagcatgaccgttcgcgagaacgtcgag
atcgcggcggtcgcggccgcacacggctccttcagcgtcgacttcctcaagcggctcgcc
gggttcgacgaggtgcacgacatcaccgatcggatgctcgattcggtcgatctcctcggc
gacgccgagatggaggcggcgagtctcccgtacggtgacaagcgccgcctggagatcgcg
atcgcgctcgcttccgagcccgatctgctgctcatggacgaaccgaccgccggcatgtcg
ccggacgagaccgcggccaccgtggacctcgtggaacagctccaggaggacctcggactc
accatcctcatcgttgaacacgacatggagatcatcttccagatagccgaccgcatcctc
gtgctgaaccgcggacaggtcatcgcggacggcactcccgaacaggtacaggaaagcgag
gaggttcaagaggcgtacctcggcggggtggagctgtga

DBGET integrated database retrieval system