Halobaculum sp. CBA1158: Hbl1158_08345 Help Entry Hbl1158_08345     CDS       T08013                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hacb  Halobaculum sp. CBA1158 Pathway hacb00280   Valine, leucine and isoleucine degradation hacb00630   Glyoxylate and dicarboxylate metabolism hacb00640   Propanoate metabolism hacb01100   Metabolic pathways hacb01110   Biosynthesis of secondary metabolites hacb01120   Microbial metabolism in diverse environments hacb01200   Carbon metabolism Module hacb_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hacb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     Hbl1158_08345    00640 Propanoate metabolism     Hbl1158_08345   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     Hbl1158_08345 Enzymes [BR:hacb01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      Hbl1158_08345     6.4.1.3  propionyl-CoA carboxylase      Hbl1158_08345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  UIO98569 LinkDB All DBs Position complement(1584291..1584575) Genome browser AA seq 94 aa AA seqDB search MTDDDSPVAERLTVPEDADDEEAAAILAAVGAHVRDAEVAAAAAADDADEAADTWDGKRW AFAGRLEGIGGRGARVPRGGPTDAWTASGRTDRF NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccgacgacgattccccggtcgccgagcgcctgaccgtccccgaggacgccgacgac gaggaggcggccgcgatactcgccgccgtcggcgcgcacgtccgcgacgccgaggtcgcg gccgccgccgctgcggacgacgcggacgaggcggcggacacgtgggacggcaagcgctgg gcgttcgccggccgactcgagggcatcggcggtcgcggcgcacgcgttccgcgggggggc ccgacggacgcgtggacggcaagcgggcgcaccgaccggttctga

DBGET integrated database retrieval system