Helicobacter apodemus: CDV25_01010 Help Entry CDV25_01010       CDS       T05516                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism had  Helicobacter apodemus Brite KEGG Orthology (KO) [BR:had00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:had03032]     CDV25_01010    03036 Chromosome and associated proteins [BR:had03036]     CDV25_01010    03400 DNA repair and recombination proteins [BR:had03400]     CDV25_01010 DNA replication proteins [BR:had03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CDV25_01010 Chromosome and associated proteins [BR:had03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CDV25_01010 DNA repair and recombination proteins [BR:had03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CDV25_01010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG DUF2267 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AWI33490 UniProt:  A0A2U8FB77 LinkDB All DBs Position 205284..205571 Genome browser AA seq 95 aa AA seqDB search MNKSEFVDLVKNVGEYETKKDAEKAISAFVASVEKALSKKESIELVGFGKFEAVLQKGKE GTVPGTNKKYKTKDKFVPKFKAGKGLKDAVAAAKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagaatttgtagatttagttaagaatgtcggtgagtatgagactaaaaaa gacgctgaaaaagctattagtgctttcgtagcttctgttgaaaaggctctttcaaaaaaa gagagtattgaattagtcggttttggtaaatttgaagcagttctccaaaaaggtaaagaa ggcactgttccaggaactaataaaaaatacaaaacaaaagataaatttgttccaaaattt aaagctggaaaaggtcttaaagacgctgttgcagcagcaaaaaaataa

DBGET integrated database retrieval system