Helicobacter apodemus: CDV25_03385 Help Entry CDV25_03385       CDS       T05516                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism had  Helicobacter apodemus Pathway had01100   Metabolic pathways had01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:had00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDV25_03385 (acpP)    00074 Mycolic acid biosynthesis     CDV25_03385 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDV25_03385 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AWI33908 UniProt:  A0A099U883 LinkDB All DBs Position complement(695860..696093) Genome browser AA seq 77 aa AA seqDB search MAIFDDVKAVVVEQLNVNEGEVKSESKFVDDLGADSLDVVELVMALEEKFEIEIPDEDAE NIATVGDVVAYIEKIKS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaatatttgatgatgtaaaagctgtggtagtggaacaattaaatgtaaatgaaggt gaggttaaatcagaatctaaatttgttgatgatttaggagctgattctttagatgttgtt gaattggtaatggcattagaagagaaatttgagattgaaattcctgatgaagatgcggag aatattgcaacagtaggcgatgtggtagcttatattgaaaagataaaatcttaa

DBGET integrated database retrieval system