KEGG   Hypericibacter adhaerens: FRZ61_13930
Entry
FRZ61_13930       CDS       T06413                                 
Name
(GenBank) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
hadh  Hypericibacter adhaerens
Pathway
hadh04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:hadh00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FRZ61_13930
Enzymes [BR:hadh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FRZ61_13930
SSDB
Motif
Pfam: Sod_Cu
Other DBs
NCBI-ProteinID: QEX21468
UniProt: A0A5J6MUX6
LinkDB
Position
complement(1575694..1576227)
AA seq 177 aa
MLFRRILPIPMTLLVLGLAAAAAEATPVSRSGNLVGADGTTLGKVTVTEAPHGVLLRLSV
EGLMPGWHGLHFHEKADCEAPGFKSAGSHVHAATPVVHGLMNPEANDDGDLPNLYVGADG
TAMVELYSTLVSMQGAGGRPALLDADGSAVVIHANPDDYMSQPIGGAGDRVACAPIK
NT seq 534 nt   +upstreamnt  +downstreamnt
atgctgttccgccgcatccttccgattccgatgacgctcctggtcctcggccttgccgcc
gctgccgcggaggccaccccggtcagccggtccggcaacctggtcggcgccgatggcacc
acgctcggcaaggtcaccgtgaccgaagccccgcatggcgtcctgctccggctttcggtc
gaggggttgatgccgggctggcatgggctgcatttccacgagaaggccgattgcgaggcg
ccgggcttcaagagcgccggcagccatgtccatgcggcgacgcccgtcgtgcacgggctg
atgaaccccgaagccaatgacgacggcgatctgccgaacctctatgtcggggcggacggg
acggccatggtcgagctctattcgacgctggtctcgatgcagggtgccggcggccggccc
gcgctgctcgacgccgacggctcggccgtggtgatccacgccaatcccgacgattacatg
tcccagccgatcggcggcgccggcgatcgcgtggcctgcgcgccgatcaagtag

DBGET integrated database retrieval system