Hypericibacter adhaerens: FRZ61_29360 Help Entry FRZ61_29360       CDS       T06413                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hadh  Hypericibacter adhaerens Pathway hadh01100   Metabolic pathways hadh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hadh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FRZ61_29360 (acpP)    00074 Mycolic acid biosynthesis     FRZ61_29360 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FRZ61_29360 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEX23001 UniProt:  A0A5J6N008 LinkDB All DBs Position complement(3335932..3336222) Genome browser AA seq 96 aa AA seqDB search MGDKGVGAMLSREAILDQLREFLGEMFEIPPERVTLEARLYQDLDLDSIDAVDLVVKLQE VTGQRIRPEAFKAVRTVGDVVDCVEELLAVNAAARP NT seq 291 nt NT seq  +upstreamnt  +downstreamnt gtgggtgacaagggggtgggggcgatgttgtctcgtgaggcgattctggatcagctgcga gaattcctgggggagatgttcgagataccgccggagcgggtcacgctggaggcccggctc tatcaggatctggacctggacagcatcgacgccgtcgatctggtggtgaagctccaggaa gtgaccggccagcggatccggccggaggctttcaaggccgtgcgcaccgtcggcgacgtg gtcgattgcgtggaagagctcctggcggtgaatgcagcggcgcgcccttaa

DBGET integrated database retrieval system