Hypericibacter adhaerens: FRZ61_29370 Help Entry FRZ61_29370       CDS       T06413                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hadh  Hypericibacter adhaerens Pathway hadh01100   Metabolic pathways hadh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hadh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FRZ61_29370    00074 Mycolic acid biosynthesis     FRZ61_29370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FRZ61_29370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEX23002 UniProt:  A0A5J6MYY2 LinkDB All DBs Position complement(3336215..3336475) Genome browser AA seq 86 aa AA seqDB search MSDTELAVKKLIIEALKLEDITPAEIDSDEPLFGSGLGLDSIDALELGVAIRRQYGIRFE TVNDEVKAHFANVRSLARFIESQRGG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtctgacacggaactggcagtcaagaaactgatcatcgaggcgctcaagctcgaggac atcacgccggcggaaatcgacagcgatgaaccgttgttcggctcgggattggggctcgat tcgatcgacgccctggagctcggcgtcgccatccgtcggcaatacggcatcaggttcgag accgtgaatgacgaggtgaaggcgcatttcgccaatgtccgaagcctggcgcgcttcatc gagagtcaaaggggtgggtga

DBGET integrated database retrieval system