Haemophilus aegyptius: NCTC8502_01084 Help Entry NCTC8502_01084    CDS       T06550                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism haeg  Haemophilus aegyptius Pathway haeg01100   Metabolic pathways haeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC8502_01084 (acpP)    00074 Mycolic acid biosynthesis     NCTC8502_01084 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC8502_01084 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  SQH36959 LinkDB All DBs Position 1:1010508..1010738 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVEQLGVKEEDVKPEASFVEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagtattgaagaacgcgtgaaaaaaatcatcgttgaacaattaggtgttaaagaagaa gatgttaaacctgaagcttcttttgttgaagatttaggtgcagattcattagacacagtt gaattagtaatggctttagaagaagaatttgatattgaaattcctgatgaagaagctgaa aaaattaccactgttcaatctgcgattgattacgtgcaaaacaatcaataa

DBGET integrated database retrieval system