Halopseudomonas aestusnigri: LO767_05465 Help Entry LO767_05465       CDS       T07924                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism haes  Halopseudomonas aestusnigri Pathway haes01100   Metabolic pathways haes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:haes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LO767_05465 (acpP)    00074 Mycolic acid biosynthesis     LO767_05465 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LO767_05465 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  UGV31933 LinkDB All DBs Position 1190770..1191006 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQEAIDYVNAHQK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtaccatcgaagaacgcgtcaagaaaatcgttgccgagcagctcggtgtcaaagaa gaagaagtaaccaacagtgcttcttttgttgaagatcttggcgctgactccctggacacc gtggagctggtgatggctctcgaagaagaattcgagaccgagattccggatgaagaagcc gagaagatcaccaccgttcaggaagctatcgactacgtgaacgctcaccagaagtaa

DBGET integrated database retrieval system