Halopseudomonas aestusnigri: LO767_17690 Help Entry LO767_17690       CDS       T07924                                  Symbol xylH Name (GenBank) 2-hydroxymuconate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism haes  Halopseudomonas aestusnigri Pathway haes00362   Benzoate degradation haes00621   Dioxin degradation haes00622   Xylene degradation haes01100   Metabolic pathways haes01120   Microbial metabolism in diverse environments haes01220   Degradation of aromatic compounds Module haes_M00569   Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA Brite KEGG Orthology (KO) [BR:haes00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     LO767_17690 (xylH)    00622 Xylene degradation     LO767_17690 (xylH)    00621 Dioxin degradation     LO767_17690 (xylH) Enzymes [BR:haes01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      LO767_17690 (xylH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  UGV30762 LinkDB All DBs Position 3794556..3794747 Genome browser AA seq 63 aa AA seqDB search MPIAQIHILEGRSDEQKEALIREVSEAIVRALDAPLPSVRVIISEMPKTHFGIGGEPASK VRR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgccgattgcacagattcatattctggaagggcgcagcgacgagcagaaggaagcgctg attcgcgaagtgagcgaggccattgtccgggcgctggatgcgcccctgccgagcgtccgg gtgatcatcagcgaaatgcccaagacacacttcggcattggtggcgagccggccagcaag gtgcgtcgctag

DBGET integrated database retrieval system