Halomonas sp. FeN2: KF947_20270 Help Entry KF947_20270       CDS       T10697                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hafn  Halomonas sp. FeN2 Pathway hafn01100   Metabolic pathways hafn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hafn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KF947_20270 (acpP)    00074 Mycolic acid biosynthesis     KF947_20270 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KF947_20270 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  UBR49625 LinkDB All DBs Position 4427266..4427499 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQNSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtactattgaagagcgcgttaagaaagttgtagcagagcgcctgaacgttaaagaa gaagacatccaaaacagctcttcttttacagaagacttgggtgctgattcgctcgacacc gttgagctggtcatggctttggaagaggaattcgatactgaaattcccgatgaagaagct gagaagatcaccacggttcaagaagccatcgattacgtgaacgcccaccagtaa

DBGET integrated database retrieval system