KEGG   Hahella sp. KA22: ENC22_26005
Entry
ENC22_26005       CDS       T05793                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
hahe  Hahella sp. KA22
Pathway
hahe00333  Prodigiosin biosynthesis
hahe01100  Metabolic pathways
hahe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ENC22_26005
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: AZZ94456
UniProt: A0A3T0VT73
LinkDB
Position
5897647..5898774
AA seq 375 aa
MPSDFTHELQETVDLARWAPSSHNSQPWTLIHIQERERANALLGDRLQEGEQCVVLALNS
ARKLKALESLEIEMLMSCGLFLGLFCMSLGVKGHDWRPRWLCEGEKDAPLTALEQEHGCL
ALTAVRITPDSIKPVSDAEEWRRLVLHRRTHRGPFNPLRISDDGLQKLLARRWPLSLTGE
HLLMRIERDPATIRRAAQLVKQYAVLDFANYKAWRETYRYIHFSLDEDAEDGFYLQSLLG
PQSKWSSLFYRCVLAPPVMQALRPFGAPQRMAEQLGALVEDSSQLLFCHLGEEHMTPKAL
TQAGARLMEVWLNAQEQKLAIHPASVMLQHDQARIEIERLRDENGRMIFFARLGAIKEVF
DKSPRRKTNGIIATG
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgccgtcggatttcacccatgaacttcaggaaactgtggatttggcgcgctgggcgccg
tcatcccacaactcgcaaccctggacgttgatacatattcaggagcgcgagcgggccaac
gcactcctcggagacaggcttcaggaaggagaacaatgtgtcgtcctggcgttgaacagc
gctcgtaaactcaaagccctggaaagtctggaaatcgaaatgctgatgagctgcggatta
tttctgggcttgttttgcatgtctctgggcgtcaaaggccatgactggcgtccgcgctgg
ctctgcgagggcgaaaaagacgctccccttacagcactggagcaggaacacggttgcctt
gcgctgacggcggtgcgtatcacgcccgacagcattaaacccgtcagcgatgcagaagaa
tggcggcgactggttctacaccggcgcacccaccgcggaccttttaatccattgcgcatc
agcgacgacggattgcagaaactgttggcgcggcgctggccattgtccttaaccggcgag
catttgctgatgcggatcgaacgcgatcccgcgacgattcgtcgcgcagcgcaactggtg
aaacagtatgcggtgctggacttcgccaactataaagcctggcgcgagacttatcgctat
atccacttttccctggatgaagacgcggaagacggattctacctgcaaagtctgctgggc
ccgcaaagcaagtggagcagtctgttctatcgttgcgtactggctccgcctgtcatgcag
gcgctgcgtcccttcggcgcgccgcaacgtatggcggaacagcttggcgcgctggtggaa
gattcatcccagttgttgttctgccatctgggagaagagcatatgacgccgaaagcgctg
actcaggctggcgcgcgcttgatggaggtttggcttaacgctcaggagcagaagctggcc
atacatccggccagcgtcatgctgcagcatgaccaggcgcgcattgagatcgagcgtctg
cgggacgaaaacgggcgcatgatttttttcgcccggcttggcgccatcaaagaagttttc
gacaaaagtcccagaagaaaaaccaacggcatcatcgccacgggataa

DBGET integrated database retrieval system