Hahella sp. KA22: ENC22_26575 Help Entry ENC22_26575       CDS       T05793                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hahe  Hahella sp. KA22 Pathway hahe01100   Metabolic pathways hahe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hahe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ENC22_26575    00074 Mycolic acid biosynthesis     ENC22_26575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ENC22_26575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AZZ94566 UniProt:  A0AAE5XMD0 LinkDB All DBs Position complement(6025832..6026083) Genome browser AA seq 83 aa AA seqDB search MSQSDTLERLKSVVGGVTRVDYEGVGLDEPLNLDSIQRISLIVALEGEFDIEIDSESLEP ETFDTFGAMATYVAGCVAESAGV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaatcggatacgctagaacgcttgaagtcagtcgtaggcggcgtcacccgcgtc gattatgaaggagtgggtctcgacgagcctctgaatctggattccattcagcgcatttcg ctgattgtggcgttggaaggggagttcgatatcgagatcgacagtgagagtctggagccg gaaacgttcgacaccttcggcgccatggcgacctatgtggcggggtgcgtagcggaatcc gccggcgtctga

DBGET integrated database retrieval system