Hahella aquimaris: O5O45_05750 Help Entry O5O45_05750       CDS       T09430                                  Name (GenBank) hypothetical protein   KO K02437   glycine cleavage system H protein Organism hahh  Hahella aquimaris Pathway hahh00260   Glycine, serine and threonine metabolism hahh00630   Glyoxylate and dicarboxylate metabolism hahh00670   One carbon pool by folate hahh00785   Lipoic acid metabolism hahh01100   Metabolic pathways hahh01110   Biosynthesis of secondary metabolites hahh01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:hahh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     O5O45_05750   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     O5O45_05750   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     O5O45_05750    00670 One carbon pool by folate     O5O45_05750 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCV_H Motif Other DBs NCBI-ProteinID:  WLQ15422 LinkDB All DBs Position complement(1212913..1213302) Genome browser AA seq 129 aa AA seqDB search MNKVTDTLRYYSCHEWVCILAGYAVVGVTDFVSELKGTLRLTCGVDYHKLYSSGERIGTL ETIKGEKLPLIIPLSGYIVSINNHPSAIINGPYGNGWLLIIKIKDYSEFGKLLSEKDYET TFRGPPSCL NT seq 390 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaggtaactgatacattgaggtattattcctgtcatgaatgggtttgtatctta gcaggctatgccgtcgttggtgtgacagactttgtctctgaacttaagggcactctcagg ctcacttgtggtgttgattaccataagctctattcatctggggaaagaataggaacgtta gagaccatcaaaggcgagaaacttcctcttattatccctctatccggctatatcgttagc atcaacaatcatccgtcagccattatcaacggtccttacggcaatggctggctactcata ataaaaattaaggattattctgaatttggcaaactactatccgagaaagattacgaaaca acttttcgaggcccgccttcatgcttatga

DBGET integrated database retrieval system