Hahella sp. HNIBRBA332: O5O45_29420 Help Entry O5O45_29420       CDS       T09430                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hahh  Hahella sp. HNIBRBA332 Pathway hahh01100   Metabolic pathways hahh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hahh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     O5O45_29420   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     O5O45_29420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WLQ13846 UniProt:  A0AA49XLR9 LinkDB All DBs Position 6597476..6597727 Genome browser AA seq 83 aa AA seqDB search MSQSDTLERLKSVVGGVTRIDYDGVGLDEPLNLDSIQRISLIVALEGEFDIEIDSESLEP ETFDTFGAMATYVAGCVAESASV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagccaatcagatacgctagaacgcttgaagtcagtcgtaggcggcgtcacccgcatc gattatgacggagtgggcctcgatgaacccctgaacctggattccattcagcgcatttca ctgattgtggcgttggagggagagttcgatatcgagatcgacagcgaaagtctggagccg gaaacgttcgacactttcggcgccatggcgacgtatgtggcggggtgcgtagcggaatcc gccagcgtctga

DBGET integrated database retrieval system