Halanaeroarchaeum sp. HSR-CO: HSRCO_2903 Help Entry HSRCO_2903        CDS       T09490                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hahs  Halanaeroarchaeum sp. HSR-CO Pathway hahs03010   Ribosome Brite KEGG Orthology (KO) [BR:hahs00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HSRCO_2903 (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HSRCO_2903 (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hahs03011]     HSRCO_2903 (rps27ae)    04121 Ubiquitin system [BR:hahs04121]     HSRCO_2903 (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hahs04147]     HSRCO_2903 (rps27ae) Ribosome [BR:hahs03011]  Ribosomal proteins   Eukaryotes    Small subunit     HSRCO_2903 (rps27ae)   Archaea     HSRCO_2903 (rps27ae) Ubiquitin system [BR:hahs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HSRCO_2903 (rps27ae) Exosome [BR:hahs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HSRCO_2903 (rps27ae)   Exosomal proteins of colorectal cancer cells    HSRCO_2903 (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Prok-RING_1 Cas12f1-like_TNB RPA_interact_C HypA Motif Other DBs NCBI-ProteinID:  UWG48888 LinkDB All DBs Position complement(2497465..2497596) Genome browser AA seq 43 aa AA seqDB search MVRGDYYEDGEATKERCPRCEDAFLADHDDRMHCGRCGYTEWK NT seq 132 nt NT seq  +upstreamnt  +downstreamnt atggtgcgcggcgactactacgaggacggcgaggccacgaaggagcgctgtccccgctgt gaggacgcgttcctcgcagaccatgacgaccgcatgcactgcggtcgctgtggttacacc gagtggaagtaa

DBGET integrated database retrieval system