KEGG   Hipposideros armiger (great roundleaf bat): 109372064
Entry
109372064         CDS       T04661                                 
Symbol
PSENEN
Name
(RefSeq) gamma-secretase subunit PEN-2
  KO
K06170  presenilin enhancer 2
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04330  Notch signaling pathway
hai05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109372064 (PSENEN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109372064 (PSENEN)
SSDB
Motif
Pfam: PEN-2
Other DBs
NCBI-GeneID: 109372064
NCBI-ProteinID: XP_019480485
UniProt: A0A8B7PVK3
LinkDB
Position
Unknown
AA seq 101 aa
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRS
AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 306 nt   +upstreamnt  +downstreamnt
atgaacttggagcgggtgtccaacgaggagaagttgaacctgtgccggaagtactacctg
ggtgggtttgctttcctgccttttctctggttggtcaacatcttctggttcttccgagag
gcattccttgtgccggcatacacagagcagagccaaatcaaaggctatgtctggcgctca
gctgtgggcttcctcttctgggtgattgtactcaccacctggatcaccattttccagatc
taccggccccgttggggtgcccttggggactatctctccttcaccatacccctgggtacc
ccctga

DBGET integrated database retrieval system