KEGG   Hipposideros armiger (great roundleaf bat): 109377015
Entry
109377015         CDS       T04661                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai01521  EGFR tyrosine kinase inhibitor resistance
hai01522  Endocrine resistance
hai04010  MAPK signaling pathway
hai04012  ErbB signaling pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04062  Chemokine signaling pathway
hai04068  FoxO signaling pathway
hai04071  Sphingolipid signaling pathway
hai04072  Phospholipase D signaling pathway
hai04137  Mitophagy - animal
hai04140  Autophagy - animal
hai04150  mTOR signaling pathway
hai04151  PI3K-Akt signaling pathway
hai04210  Apoptosis
hai04211  Longevity regulating pathway
hai04213  Longevity regulating pathway - multiple species
hai04218  Cellular senescence
hai04360  Axon guidance
hai04370  VEGF signaling pathway
hai04371  Apelin signaling pathway
hai04540  Gap junction
hai04550  Signaling pathways regulating pluripotency of stem cells
hai04625  C-type lectin receptor signaling pathway
hai04650  Natural killer cell mediated cytotoxicity
hai04660  T cell receptor signaling pathway
hai04662  B cell receptor signaling pathway
hai04664  Fc epsilon RI signaling pathway
hai04714  Thermogenesis
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04725  Cholinergic synapse
hai04726  Serotonergic synapse
hai04730  Long-term depression
hai04810  Regulation of actin cytoskeleton
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04917  Prolactin signaling pathway
hai04919  Thyroid hormone signaling pathway
hai04921  Oxytocin signaling pathway
hai04926  Relaxin signaling pathway
hai04929  GnRH secretion
hai04933  AGE-RAGE signaling pathway in diabetic complications
hai04935  Growth hormone synthesis, secretion and action
hai05010  Alzheimer disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05034  Alcoholism
hai05160  Hepatitis C
hai05161  Hepatitis B
hai05163  Human cytomegalovirus infection
hai05165  Human papillomavirus infection
hai05166  Human T-cell leukemia virus 1 infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05203  Viral carcinogenesis
hai05205  Proteoglycans in cancer
hai05206  MicroRNAs in cancer
hai05207  Chemical carcinogenesis - receptor activation
hai05208  Chemical carcinogenesis - reactive oxygen species
hai05210  Colorectal cancer
hai05211  Renal cell carcinoma
hai05213  Endometrial cancer
hai05214  Glioma
hai05215  Prostate cancer
hai05216  Thyroid cancer
hai05218  Melanoma
hai05219  Bladder cancer
hai05220  Chronic myeloid leukemia
hai05221  Acute myeloid leukemia
hai05223  Non-small cell lung cancer
hai05224  Breast cancer
hai05225  Hepatocellular carcinoma
hai05226  Gastric cancer
hai05230  Central carbon metabolism in cancer
hai05231  Choline metabolism in cancer
hai05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hai05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109377015 (NRAS)
   04012 ErbB signaling pathway
    109377015 (NRAS)
   04014 Ras signaling pathway
    109377015 (NRAS)
   04015 Rap1 signaling pathway
    109377015 (NRAS)
   04370 VEGF signaling pathway
    109377015 (NRAS)
   04371 Apelin signaling pathway
    109377015 (NRAS)
   04068 FoxO signaling pathway
    109377015 (NRAS)
   04072 Phospholipase D signaling pathway
    109377015 (NRAS)
   04071 Sphingolipid signaling pathway
    109377015 (NRAS)
   04151 PI3K-Akt signaling pathway
    109377015 (NRAS)
   04150 mTOR signaling pathway
    109377015 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109377015 (NRAS)
   04137 Mitophagy - animal
    109377015 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    109377015 (NRAS)
   04218 Cellular senescence
    109377015 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109377015 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    109377015 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109377015 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109377015 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    109377015 (NRAS)
   04660 T cell receptor signaling pathway
    109377015 (NRAS)
   04662 B cell receptor signaling pathway
    109377015 (NRAS)
   04664 Fc epsilon RI signaling pathway
    109377015 (NRAS)
   04062 Chemokine signaling pathway
    109377015 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109377015 (NRAS)
   04929 GnRH secretion
    109377015 (NRAS)
   04912 GnRH signaling pathway
    109377015 (NRAS)
   04915 Estrogen signaling pathway
    109377015 (NRAS)
   04917 Prolactin signaling pathway
    109377015 (NRAS)
   04921 Oxytocin signaling pathway
    109377015 (NRAS)
   04926 Relaxin signaling pathway
    109377015 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    109377015 (NRAS)
   04919 Thyroid hormone signaling pathway
    109377015 (NRAS)
   04916 Melanogenesis
    109377015 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    109377015 (NRAS)
   04726 Serotonergic synapse
    109377015 (NRAS)
   04720 Long-term potentiation
    109377015 (NRAS)
   04730 Long-term depression
    109377015 (NRAS)
   04722 Neurotrophin signaling pathway
    109377015 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    109377015 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    109377015 (NRAS)
   04213 Longevity regulating pathway - multiple species
    109377015 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    109377015 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109377015 (NRAS)
   05206 MicroRNAs in cancer
    109377015 (NRAS)
   05205 Proteoglycans in cancer
    109377015 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    109377015 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    109377015 (NRAS)
   05203 Viral carcinogenesis
    109377015 (NRAS)
   05230 Central carbon metabolism in cancer
    109377015 (NRAS)
   05231 Choline metabolism in cancer
    109377015 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109377015 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109377015 (NRAS)
   05225 Hepatocellular carcinoma
    109377015 (NRAS)
   05226 Gastric cancer
    109377015 (NRAS)
   05214 Glioma
    109377015 (NRAS)
   05216 Thyroid cancer
    109377015 (NRAS)
   05221 Acute myeloid leukemia
    109377015 (NRAS)
   05220 Chronic myeloid leukemia
    109377015 (NRAS)
   05218 Melanoma
    109377015 (NRAS)
   05211 Renal cell carcinoma
    109377015 (NRAS)
   05219 Bladder cancer
    109377015 (NRAS)
   05215 Prostate cancer
    109377015 (NRAS)
   05213 Endometrial cancer
    109377015 (NRAS)
   05224 Breast cancer
    109377015 (NRAS)
   05223 Non-small cell lung cancer
    109377015 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109377015 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    109377015 (NRAS)
   05161 Hepatitis B
    109377015 (NRAS)
   05160 Hepatitis C
    109377015 (NRAS)
   05163 Human cytomegalovirus infection
    109377015 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109377015 (NRAS)
   05165 Human papillomavirus infection
    109377015 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109377015 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    109377015 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    109377015 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109377015 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109377015 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109377015 (NRAS)
   01522 Endocrine resistance
    109377015 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109377015 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109377015 (NRAS)
   04031 GTP-binding proteins [BR:hai04031]
    109377015 (NRAS)
Membrane trafficking [BR:hai04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    109377015 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109377015 (NRAS)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109377015 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   109377015 (NRAS)
  Exosomal proteins of breast cancer cells
   109377015 (NRAS)
  Exosomal proteins of colorectal cancer cells
   109377015 (NRAS)
GTP-binding proteins [BR:hai04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109377015 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 109377015
NCBI-ProteinID: XP_019488768
UniProt: A0A8B7QM47
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLSSSDDGTQG
CMGLPCMVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcgctgacc
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgcctgttggacatcctggatacagccgga
caagaggagtacagtgctatgagagaccagtacatgaggacaggcgaaggtttcctctgc
gtatttgccatcaacaacagcaagtcatttgcagatattaacctctacagggaacagatt
aagcgagtaaaggactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgcgttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcagcagcagtgatgatggcactcaaggt
tgcatgggcttgccttgtatggtgatgtaa

DBGET integrated database retrieval system