KEGG   Hipposideros armiger (great roundleaf bat): 109383796
Entry
109383796         CDS       T04661                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04014  Ras signaling pathway
hai04015  Rap1 signaling pathway
hai04020  Calcium signaling pathway
hai04022  cGMP-PKG signaling pathway
hai04024  cAMP signaling pathway
hai04070  Phosphatidylinositol signaling system
hai04114  Oocyte meiosis
hai04218  Cellular senescence
hai04261  Adrenergic signaling in cardiomyocytes
hai04270  Vascular smooth muscle contraction
hai04371  Apelin signaling pathway
hai04625  C-type lectin receptor signaling pathway
hai04713  Circadian entrainment
hai04720  Long-term potentiation
hai04722  Neurotrophin signaling pathway
hai04728  Dopaminergic synapse
hai04740  Olfactory transduction
hai04744  Phototransduction
hai04750  Inflammatory mediator regulation of TRP channels
hai04910  Insulin signaling pathway
hai04912  GnRH signaling pathway
hai04915  Estrogen signaling pathway
hai04916  Melanogenesis
hai04921  Oxytocin signaling pathway
hai04922  Glucagon signaling pathway
hai04924  Renin secretion
hai04925  Aldosterone synthesis and secretion
hai04970  Salivary secretion
hai04971  Gastric acid secretion
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05031  Amphetamine addiction
hai05034  Alcoholism
hai05133  Pertussis
hai05152  Tuberculosis
hai05163  Human cytomegalovirus infection
hai05167  Kaposi sarcoma-associated herpesvirus infection
hai05170  Human immunodeficiency virus 1 infection
hai05200  Pathways in cancer
hai05214  Glioma
hai05417  Lipid and atherosclerosis
hai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109383796
   04015 Rap1 signaling pathway
    109383796
   04371 Apelin signaling pathway
    109383796
   04020 Calcium signaling pathway
    109383796
   04070 Phosphatidylinositol signaling system
    109383796
   04024 cAMP signaling pathway
    109383796
   04022 cGMP-PKG signaling pathway
    109383796
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109383796
   04218 Cellular senescence
    109383796
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109383796
  09152 Endocrine system
   04910 Insulin signaling pathway
    109383796
   04922 Glucagon signaling pathway
    109383796
   04912 GnRH signaling pathway
    109383796
   04915 Estrogen signaling pathway
    109383796
   04921 Oxytocin signaling pathway
    109383796
   04916 Melanogenesis
    109383796
   04924 Renin secretion
    109383796
   04925 Aldosterone synthesis and secretion
    109383796
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109383796
   04270 Vascular smooth muscle contraction
    109383796
  09154 Digestive system
   04970 Salivary secretion
    109383796
   04971 Gastric acid secretion
    109383796
  09156 Nervous system
   04728 Dopaminergic synapse
    109383796
   04720 Long-term potentiation
    109383796
   04722 Neurotrophin signaling pathway
    109383796
  09157 Sensory system
   04744 Phototransduction
    109383796
   04740 Olfactory transduction
    109383796
   04750 Inflammatory mediator regulation of TRP channels
    109383796
  09159 Environmental adaptation
   04713 Circadian entrainment
    109383796
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109383796
  09162 Cancer: specific types
   05214 Glioma
    109383796
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109383796
   05163 Human cytomegalovirus infection
    109383796
   05167 Kaposi sarcoma-associated herpesvirus infection
    109383796
  09171 Infectious disease: bacterial
   05133 Pertussis
    109383796
   05152 Tuberculosis
    109383796
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109383796
   05012 Parkinson disease
    109383796
   05022 Pathways of neurodegeneration - multiple diseases
    109383796
  09165 Substance dependence
   05031 Amphetamine addiction
    109383796
   05034 Alcoholism
    109383796
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109383796
   05418 Fluid shear stress and atherosclerosis
    109383796
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hai01009]
    109383796
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hai04131]
    109383796
   03036 Chromosome and associated proteins [BR:hai03036]
    109383796
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hai04147]
    109383796
Protein phosphatases and associated proteins [BR:hai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     109383796
Membrane trafficking [BR:hai04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    109383796
Chromosome and associated proteins [BR:hai03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     109383796
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109383796
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EH EF_EFCAB10_C SPARC_Ca_bdg UPF0154 Dockerin_1 Temptin_C FCaBP_EF-hand WEF-hand MTIP_N DUF5580_M DUF3008 SurA_N_2 DUF3939
Other DBs
NCBI-GeneID: 109383796
NCBI-ProteinID: XP_019500082
UniProt: A0A8B7RGX7
LinkDB
Position
Unknown
AA seq 149 aa
MAEELPKEQVAEFKAAFTRFDKNGDGTISVQELGDVMRTLGQNPSEAELKDIIARVDTDG
DGAISFEEFLAAMVKRMKSMGGDHDMREVFQAFDLDGDGHITVDELKQAMAQVGEKLSQK
ELEAMIREADVDQDGKVNYEEFARMLSQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggcagaggaactacctaaagagcaggtggccgagttcaaggcagccttcacccggttc
gacaagaacggggacggcaccatcagcgtgcaagagctgggcgatgtcatgcggaccctg
ggccagaacccgtcagaggccgagctgaaggacatcatcgcccgggtggacacagacggc
gacggtgccatcagcttcgaagagttcctggcagcgatggtcaagaggatgaagtccatg
ggcggcgatcatgacatgcgggaggtcttccaagccttcgacctggacggtgacggccac
atcaccgtggacgagctcaagcaggccatggcccaggtcggggagaagctctcccagaag
gagctggaggccatgatccgggaggcggacgtggaccaggacgggaaggtgaactacgag
gagttcgctcgcatgctctcccagaagtga

DBGET integrated database retrieval system