KEGG   Hipposideros armiger (great roundleaf bat): 109389274
Entry
109389274         CDS       T04661                                 
Symbol
NDUFS8
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:7.1.1.2]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai00190  Oxidative phosphorylation
hai01100  Metabolic pathways
hai04714  Thermogenesis
hai04723  Retrograde endocannabinoid signaling
hai04932  Non-alcoholic fatty liver disease
hai05010  Alzheimer disease
hai05012  Parkinson disease
hai05014  Amyotrophic lateral sclerosis
hai05016  Huntington disease
hai05020  Prion disease
hai05022  Pathways of neurodegeneration - multiple diseases
hai05208  Chemical carcinogenesis - reactive oxygen species
hai05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hai00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109389274 (NDUFS8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    109389274 (NDUFS8)
  09159 Environmental adaptation
   04714 Thermogenesis
    109389274 (NDUFS8)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    109389274 (NDUFS8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109389274 (NDUFS8)
   05012 Parkinson disease
    109389274 (NDUFS8)
   05014 Amyotrophic lateral sclerosis
    109389274 (NDUFS8)
   05016 Huntington disease
    109389274 (NDUFS8)
   05020 Prion disease
    109389274 (NDUFS8)
   05022 Pathways of neurodegeneration - multiple diseases
    109389274 (NDUFS8)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    109389274 (NDUFS8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109389274 (NDUFS8)
Enzymes [BR:hai01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     109389274 (NDUFS8)
SSDB
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_8 Fer4_21 Fer4_10 Fer4_6 Fer4_2 Fer4_9 Fer4_3 Fer4_17 Fer4_4
Other DBs
NCBI-GeneID: 109389274
NCBI-ProteinID: XP_019510201
UniProt: A0A8B7SA60
LinkDB
Position
Unknown
AA seq 161 aa
PIERKAFLDPASFDCIIGQSDHTMKGQRGEGEASRPNGSVPECRLRLSADRPLGLDPVPR
PQRGWQATVPCAAPQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGP
NFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 486 nt   +upstreamnt  +downstreamnt
ccaatcgaaagaaaggcatttctggatcccgcctctttcgactgcatcattggccaatca
gaccacaccatgaagggtcagcgcggagaaggcgaggccagccggcccaatggcagcgtc
ccagagtgtaggctccgcctctcggcggacaggccgctcgggctggaccctgtgcccaga
ccccagcgtggctggcaggcgacagtaccctgtgccgctccccaggccatcaccatcgag
gccgagcctcgggctgacggcagccgccggaccacccgctatgacattgacatgaccaag
tgcatctactgcggcttctgccaggaggcctgccctgtggacgccatcgttgagggcccc
aactttgagttctccacggagacgcacgaggagctactgtacaacaaggagaagctgctg
aacaatggagacaagtgggaggccgagattgccgccaacatccaggccgactatctctac
cggtga

DBGET integrated database retrieval system