Hipposideros armiger (great roundleaf bat): 109393998
Help
Entry
109393998 CDS
T04661
Symbol
MRPL18
Name
(RefSeq) 39S ribosomal protein L18, mitochondrial
KO
K02881
large subunit ribosomal protein L18
Organism
hai
Hipposideros armiger (great roundleaf bat)
Pathway
hai03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
hai00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
109393998 (MRPL18)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
hai03011
]
109393998 (MRPL18)
Ribosome [BR:
hai03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
109393998 (MRPL18)
Bacteria
109393998 (MRPL18)
Archaea
109393998 (MRPL18)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-GeneID:
109393998
NCBI-ProteinID:
XP_019519297
UniProt:
A0A8B7T0V8
LinkDB
All DBs
Position
Unknown
AA seq
112 aa
AA seq
DB search
MFGLLLRTPFQRLRVVRTQHHIEALVEHCSGRVVVSASTREWAIKKHLYSTRNVVACESI
GRVLAERCLEAGINFMVYQPTPWEAASDSIKLLQSAMTEGGVMLQEPRRIYG
NT seq
339 nt
NT seq
+upstream
nt +downstream
nt
atgtttggtttgttattgagaacaccctttcaaaggttgcgagttgtacggacgcagcat
catatagaagcgcttgttgaacattgcagtggccgggttgtggtttcggcatccactcgt
gaatgggctattaaaaagcacctttacagcaccagaaacgtggtggcttgcgagagtata
ggtcgagtgctggcagaacggtgcttagaggctggaatcaacttcatggtctaccaacca
actccttgggaggcagcctcagactcgataaaactactgcagagtgctatgacagaaggt
ggtgtgatgctgcaggagccgcggaggatctatggatga
DBGET
integrated database retrieval system