Helicobacter ailurogastricus: ASB7_05110 Help Entry ASB7_05110        CDS       T08780                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hail  Helicobacter ailurogastricus Pathway hail01100   Metabolic pathways hail01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hail00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASB7_05110 (acpP)    00074 Mycolic acid biosynthesis     ASB7_05110 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASB7_05110 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N EFP Ribosomal_L50 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  BDQ28674 LinkDB All DBs Position complement(476727..476963) Genome browser AA seq 78 aa AA seqDB search MALFEDVQAVIVEQLNVSASQVTEEADFIKDLNADSLDVVELIMALEEKFGIEIPDEQAE KIKTVGDALRFIQDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttgtttgaagatgtacaggcggtgattgtagagcagttaaatgtgagtgcatcg caggttactgaggaggcggattttatcaaggatttaaacgcggattcgcttgatgtggtg gagctcatcatggctcttgaggaaaaatttgggattgagatccccgatgagcaagctgaa aagattaaaacagtgggtgatgcgctccgcttcattcaagacaataaactcgcttag

DBGET integrated database retrieval system