Hemitrygon akajei (red stingray): 140735939 Help Entry 140735939         CDS       T11019                                  Symbol bcl2l1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism haka  Hemitrygon akajei (red stingray) Pathway haka04115   p53 signaling pathway haka04137   Mitophagy - animal haka04140   Autophagy - animal haka04210   Apoptosis haka04621   NOD-like receptor signaling pathway haka05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:haka00001]  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     140735939 (bcl2l1)    04137 Mitophagy - animal     140735939 (bcl2l1)   09143 Cell growth and death    04210 Apoptosis     140735939 (bcl2l1)    04115 p53 signaling pathway     140735939 (bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     140735939 (bcl2l1)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     140735939 (bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:haka01009]     140735939 (bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:haka03036]     140735939 (bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:haka02000]     140735939 (bcl2l1) Protein phosphatases and associated proteins [BR:haka01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      140735939 (bcl2l1) Chromosome and associated proteins [BR:haka03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     140735939 (bcl2l1) Transporters [BR:haka02000]  Other transporters   Pores ion channels [TC:1]    140735939 (bcl2l1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 HTH_Tnp_ISL3 Bcl-2_3 HTH_AsnC-type Myb_DNA-binding_7 Phenyl_P_gamma Motif Other DBs NCBI-GeneID:  140735939 NCBI-ProteinID:  XP_072917655 LinkDB All DBs Position 11:115705604..115724549 Genome browser AA seq 203 aa AA seqDB search MCSSRELVTNFLRYKLQQRGHSWSQLCEQDGAAGSDHQPDGVATELDAGPEAERTCRALR EAAEEFELRYRRAFSDLSAQLRVTPDTVYRRFEQVVGELFRDGVNWGRLVAFFCFGAALC VECAEKEMGALVRRIAHWMSTYLENNLEPWIQQEGGWDAFVMLYGNNAAARNREIQEMAM KCLMSLMALGAVLALAMYLTRRR NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgtgcagcagcagagagctggtcaccaacttcctccgctacaagctgcagcaacgaggc cacagttggagtcagctgtgtgaacaggatggcgcagcggggtctgaccaccagcccgac ggggtggccaccgaactggacgctgggcccgaggccgagcgcacctgtcgggccctgcga gaggcggccgaggagttcgagctgcgctacaggcgcgccttcagcgatctgtcggcgcag ctgcgcgtcaccccggacacggtctaccggcgctttgagcaggtggtgggcgagttgttc cgagacggcgtcaattggggccgtctggtcgccttcttctgttttggagcggcgctgtgt gtggagtgcgccgagaaggagatgggtgcactggtgcgtcggatagcccactggatgagc acttatctggagaacaacctggagccgtggatccaacaagagggaggctgggatgccttt gtgatgttatatgggaataatgctgctgctcgtaaccgtgagatacaggagatggccatg aaatgtttaatgagcctaatggctttgggggcagtgctggcccttgctatgtacctgacc cggagaaggtaa

DBGET integrated database retrieval system