Hemitrygon akajei (red stingray): 140738938 Help Entry 140738938         CDS       T11019                                  Name (RefSeq) uncharacterized protein   KO K04551   ubiquitin B Organism haka  Hemitrygon akajei (red stingray) Pathway haka04120   Ubiquitin mediated proteolysis haka04137   Mitophagy - animal haka04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:haka00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     140738938  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     140738938    04137 Mitophagy - animal     140738938  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:haka04121]     140738938   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:haka04147]     140738938 Ubiquitin system [BR:haka04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    140738938 Exosome [BR:haka04147]  Exosomal proteins   Exosomal proteins of breast milk    140738938   Exosomal proteins of other body fluids (saliva and urine)    140738938   Exosomal proteins of colorectal cancer cells    140738938   Exosomal proteins of bladder cancer cells    140738938 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD OTU1_UBXL UN_NPL4 Motif Other DBs NCBI-GeneID:  140738938 NCBI-ProteinID:  XP_072923051 LinkDB All DBs Position 14:complement(32126804..32127271) Genome browser AA seq 155 aa AA seqDB search MRLQVKFITGEGIELDVDPSIQVSTLKMKIQEKTNVPISQQRLMVQNGQSVEMQDNRSLS YYNLNPSPTVMLLVRKEEFMQIFLQNDKGKTTTYDVLPSETVQSFKERVHRQEGVRPDQQ RLVYEGKQLEDGRLLSDYNIRPLTTISLLLRLRGG NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgagacttcaggtgaagtttatcaccggcgagggtatcgaacttgatgtcgacccttcc attcaagtgtcgactctcaagatgaaaatccaggaaaagaccaacgtgcccatttcccaa cagcgtctgatggtacaaaatggtcaaagcgtggagatgcaggacaacagaagcctaagc tactacaacctcaaccccagccccaccgtgatgctgctggtcaggaaagaggaattcatg cagatatttctccagaatgacaaggggaaaaccacgacctacgatgtgctgccctctgag accgtgcagagttttaaagagcgagtccatcggcaggagggggtcagacccgatcagcag cgcctggtttatgagggcaaacagttggaggatggccgattgctttccgactacaacatc agaccactaaccaccatctctctgctgctccgtctacgtggaggctga

DBGET integrated database retrieval system