Hemitrygon akajei (red stingray): 140741699 Help Entry 140741699         CDS       T11019                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism haka  Hemitrygon akajei (red stingray) Pathway haka04137   Mitophagy - animal haka04140   Autophagy - animal haka04144   Endocytosis haka04145   Phagosome haka04148   Efferocytosis haka05132   Salmonella infection Brite KEGG Orthology (KO) [BR:haka00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     140741699    04145 Phagosome     140741699    04140 Autophagy - animal     140741699    04137 Mitophagy - animal     140741699    04148 Efferocytosis     140741699  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     140741699  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:haka04131]     140741699   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:haka04147]     140741699    04031 GTP-binding proteins [BR:haka04031]     140741699 Membrane trafficking [BR:haka04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     140741699 Exosome [BR:haka04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    140741699   Exosomal proteins of other body fluids (saliva and urine)    140741699   Exosomal proteins of colorectal cancer cells    140741699   Exosomal proteins of bladder cancer cells    140741699 GTP-binding proteins [BR:haka04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     140741699 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 NTPase_1 AAA_7 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  140741699 NCBI-ProteinID:  XP_072928088 LinkDB All DBs Position 19:complement(3723621..3772019) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKTSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacgtctaggaagaaagttttgctgaaagtcatcatcttgggcgattcaggggtagga aagacctcactgatgaaccagtatgtaaacaaaaagttcagtaaccaatacaaggcaaca ataggggcagactttctaacgaaggaggtgatggtggacgatagattggtgacaatgcag atatgggacacagcagggcaagagcgttttcagtcattgggtgtggccttctacagaggg gctgactgctgcgtgctggtctttgatgtaacggcgcccaatacgttcaagacccttgat agttggagagatgaatttctcattcaagctagtccacgagatccagaaaactttcccttt gtggtccttggtaacaagatagacctggaaaacagacaggtcaccacaaaaagagcacag gcatggtgtcagagtaaaaataacataccctactttgaaaccagcgcaaaggaggcaata aatgtggaacaggcttttcagacaattgcacggaatgcacttaaacaggaaacagaagtg gagctctacaacgaattcccagaaccaatcaaactagacaagaacgaccgggcaaagact tcagcagagagctgcagctgctga

DBGET integrated database retrieval system