Haloterrigena alkaliphila: J0X25_03120 Help Entry J0X25_03120       CDS       T07793                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hakz  Haloterrigena alkaliphila Pathway hakz03010   Ribosome Brite KEGG Orthology (KO) [BR:hakz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     J0X25_03120   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     J0X25_03120  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hakz03011]     J0X25_03120    04121 Ubiquitin system [BR:hakz04121]     J0X25_03120   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hakz04147]     J0X25_03120 Ribosome [BR:hakz03011]  Ribosomal proteins   Eukaryotes    Small subunit     J0X25_03120   Archaea     J0X25_03120 Ubiquitin system [BR:hakz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    J0X25_03120 Exosome [BR:hakz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    J0X25_03120   Exosomal proteins of colorectal cancer cells    J0X25_03120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Zn_ribbon_RPB9 Rcat_RNF216 Zn_Ribbon_TF Ribosomal_L37e Zn_ribbon_3 Cas12f1-like_TNB zf-C2H2_FBX41 DUF7575 HypA DUF5817 Motif Other DBs NCBI-ProteinID:  QSW99969 UniProt:  A0A8A2VD57 LinkDB All DBs Position 630032..630166 Genome browser AA seq 44 aa AA seqDB search MARHELYEDDGSTEREQCPRCGDAFLADHGDRQHCGKCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggctcgccacgaactctacgaagacgacggcagcacggaacgcgaacagtgcccccgc tgcggggacgccttcctcgccgaccacggcgaccgccagcactgcgggaagtgcggttac accgagtgggagtag

DBGET integrated database retrieval system