Haloterrigena alkaliphila: J0X25_03650 Help Entry J0X25_03650       CDS       T07793                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hakz  Haloterrigena alkaliphila Pathway hakz03010   Ribosome Brite KEGG Orthology (KO) [BR:hakz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     J0X25_03650   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     J0X25_03650  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hakz03011]     J0X25_03650    04121 Ubiquitin system [BR:hakz04121]     J0X25_03650 Ribosome [BR:hakz03011]  Ribosomal proteins   Eukaryotes    Large subunit     J0X25_03650   Archaea     J0X25_03650 Ubiquitin system [BR:hakz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    J0X25_03650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 zf-CHY DZR Ribosomal_L37e DZR_2 Zn_ribbon_RPAB4 DUF7577 HypA DUF6395 Motif Other DBs NCBI-ProteinID:  QSX00074 UniProt:  A0A8A2VDD7 LinkDB All DBs Position 755142..755291 Genome browser AA seq 49 aa AA seqDB search MPSFDAAEERTLKKMICMRCNARNPQKADRCRKCGYKNLRPKATEPRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgccaagtttcgacgccgccgaggaacggacgctcaagaagatgatctgcatgcgctgt aacgcccgcaacccacagaaagccgaccgctgccgaaagtgcggttacaagaacctccgt cccaaggcgacggaaccccgcgcggcgtaa

DBGET integrated database retrieval system