Haloterrigena alkaliphila: J0X25_15445 Help Entry J0X25_15445       CDS       T07793                                  Name (GenBank) hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hakz  Haloterrigena alkaliphila Pathway hakz00280   Valine, leucine and isoleucine degradation hakz00630   Glyoxylate and dicarboxylate metabolism hakz00640   Propanoate metabolism hakz01100   Metabolic pathways hakz01110   Biosynthesis of secondary metabolites hakz01120   Microbial metabolism in diverse environments hakz01200   Carbon metabolism Module hakz_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hakz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     J0X25_15445    00640 Propanoate metabolism     J0X25_15445   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     J0X25_15445 Enzymes [BR:hakz01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      J0X25_15445     6.4.1.3  propionyl-CoA carboxylase      J0X25_15445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  QSX01212 UniProt:  A0A8A2VI60 LinkDB All DBs Position complement(3173244..3173507) Genome browser AA seq 87 aa AA seqDB search MPADVELELPDDATEDEAAAIAAAIGAHLHDQALAAAAAAAAGEEETWDEKRWSFAGRIR AQQHRTVRVPRSAPINPWSAAGRTDRF NT seq 264 nt NT seq  +upstreamnt  +downstreamnt ttgccggcggacgtcgaactcgagttacccgacgacgcgaccgaggacgaagccgcggcg atcgcggcagctatcggcgcgcacctccacgatcaggcgctcgcggcggcagcggccgcc gcggccggggaggaggagacgtgggacgagaagcgctggtcgttcgcgggccggatccgc gcccagcaacaccggaccgtccgcgtcccccgatcggcaccgatcaacccgtggtcggcc gcagggcgaacggatcggttctga

DBGET integrated database retrieval system