Halobacterium salinarum NRC-1: VNG_1530H Help Entry VNG_1530H         CDS       T00038                                  Name (GenBank) hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hal  Halobacterium salinarum NRC-1 Pathway hal00280   Valine, leucine and isoleucine degradation hal00630   Glyoxylate and dicarboxylate metabolism hal00640   Propanoate metabolism hal01100   Metabolic pathways hal01110   Biosynthesis of secondary metabolites hal01120   Microbial metabolism in diverse environments hal01200   Carbon metabolism Module hal_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hal00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     VNG_1530H    00640 Propanoate metabolism     VNG_1530H   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     VNG_1530H Enzymes [BR:hal01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      VNG_1530H     6.4.1.3  propionyl-CoA carboxylase      VNG_1530H BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HD-CE Motif Other DBs NCBI-ProteinID:  AAG19818 UniProt:  Q9HPP9 LinkDB All DBs Position 1139055..1139312 Genome browser AA seq 85 aa AA seqDB search MPAEMDLTIPEDASEEEAAAIAAAVQSHLAAMAAAAAAADDNEATWPGEKWRFAGRVEQQ GGRSVRVPDGAPTDAWSAAGRRDRF NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcccgccgagatggacctgacgatccccgaggacgccagcgaggaggaggccgccgcc atcgctgcggccgtccagagccacctggccgcgatggcggcggccgcggcagccgccgac gacaacgaggcgacgtggcccggtgagaaatggcggttcgccggccgcgtcgaacaacag ggcgggcgctcggtgcgcgtgcccgacggtgcgcccaccgacgcgtggagcgcggcgggg cgtcgcgaccggttttag

DBGET integrated database retrieval system