Halobacterium salinarum NRC-1: VNG_2047G Help Entry VNG_2047G         CDS       T00038                                  Symbol rps27ae Name (GenBank) 30S ribosomal protein S27E   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hal  Halobacterium salinarum NRC-1 Pathway hal03010   Ribosome Brite KEGG Orthology (KO) [BR:hal00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     VNG_2047G (rps27ae)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     VNG_2047G (rps27ae)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hal03011]     VNG_2047G (rps27ae)    04121 Ubiquitin system [BR:hal04121]     VNG_2047G (rps27ae)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hal04147]     VNG_2047G (rps27ae) Ribosome [BR:hal03011]  Ribosomal proteins   Eukaryotes    Small subunit     VNG_2047G (rps27ae)   Archaea     VNG_2047G (rps27ae) Ubiquitin system [BR:hal04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    VNG_2047G (rps27ae) Exosome [BR:hal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    VNG_2047G (rps27ae)   Exosomal proteins of colorectal cancer cells    VNG_2047G (rps27ae) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_19 Ribosomal_L37e Zn_ribbon_RPB9 Zn_Ribbon_TF Prok-RING_1 DZR_2 zf-FPG_IleRS FYVE DZR Zn_ribbon_3 Cas12f1-like_TNB zf-C2H2_FBX41 zf_UBZ Motif Other DBs NCBI-ProteinID:  AAG20205 UniProt:  Q9HNL5 A0A510N8H6 LinkDB All DBs Position complement(1508435..1508569) Genome browser AA seq 44 aa AA seqDB search MARGDYYSDDGTTDKEMCPRCGDTFLAAHDDRQVCGRCGYTEWE NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcggtgactactacagcgacgacggcacgacggacaaggagatgtgcccgcgc tgcggggacacgttcctcgcggcccacgacgaccgccaggtgtgtgggcgctgcgggtac accgagtgggagtaa

DBGET integrated database retrieval system