KEGG   Halorhabdus sp. CBA1104: Hrd1104_05585
Entry
Hrd1104_05585     CDS       T06289                                 
Name
(GenBank) proteasome assembly chaperone family protein
  KO
K06869  uncharacterized protein
Organism
hala  Halorhabdus sp. CBA1104
Brite
KEGG Orthology (KO) [BR:hala00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Hrd1104_05585
SSDB
Motif
Pfam: PAC2 IU_nuc_hydro
Other DBs
NCBI-ProteinID: QGN06815
LinkDB
Position
complement(1076188..1076925)
AA seq 245 aa
MAHIAVHDAELTLEDPMLVEGFPGAGLVGKIAADHLVDSYEMTHYATCHCEGLPEVAVYH
ENETSIAGPVRIYADEARELLVLQSDVPVSPEAAEEFAGCVTVWLDEQDALPIYLSGIPV
DPDGNRELYGVATGRAEAQLRDHDIATPDERGAISGPTGALLYEATREDLDSIGLLVEAS
SQFPDPAAAKILLEKGIATLAQIDVTTETLVEQAEEIRIARKKLAKQMQQASDESSKAEP
VGMYQ
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcacatattgcagttcacgatgcggagctgacgctcgaggacccgatgctcgtcgag
ggattcccgggtgccggcctcgtcgggaaaatcgctgccgatcacctggtcgatagctac
gagatgactcactacgcgacctgccattgtgagggcctgcccgaagttgcggtctaccac
gagaacgagacctcgatcgccgggccggtcaggatctacgccgacgaggcacgtgagttg
ctcgtcctccagagcgacgtgcccgtctctccagaagctgccgaggagttcgccggctgt
gtgacggtctggctcgacgagcaagacgccttgccgatctacctcagtggcatccctgtc
gatccggacggcaatcgtgagctgtatggtgttgcaaccgggcgagctgaggcccaactg
cgcgatcacgacattgccacgcccgacgaacgcggcgcgatcagcgggccaacgggggcg
ctcctgtacgaagccactcgcgaggacctcgacagcatcgggctgctcgtcgaggcgtct
tcgcagtttccagatccagccgccgccaagatcttacttgagaagggaatcgccacactt
gcccagatcgacgtcacgaccgagacgctcgtcgaacaggccgaggaaatccgcatcgcg
cgcaagaaactggcaaagcagatgcaacaggcaagcgacgagagctcgaaggccgagcca
gtcgggatgtaccagtag

DBGET integrated database retrieval system