Halorubrum sp. BOL3-1: EKH57_10125 Help Entry EKH57_10125       CDS       T05834                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism halb  Halorubrum sp. BOL3-1 Pathway halb03010   Ribosome Brite KEGG Orthology (KO) [BR:halb00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     EKH57_10125   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     EKH57_10125  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:halb03011]     EKH57_10125    04121 Ubiquitin system [BR:halb04121]     EKH57_10125 Ribosome [BR:halb03011]  Ribosomal proteins   Eukaryotes    Large subunit     EKH57_10125   Archaea     EKH57_10125 Ubiquitin system [BR:halb04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    EKH57_10125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 Zn_ribbon_RPAB4 Zn_ribbon_3 DUF7577 Motif Other DBs NCBI-ProteinID:  QAU13049 UniProt:  A0A410TQD2 LinkDB All DBs Position complement(1896058..1896207) Genome browser AA seq 49 aa AA seqDB search MAKFDAAERRMLDRQICMRCNARNASEAERCRKCGYTNLRPKATERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccaaatttgacgccgcggaacgccggatgctcgaccgacagatctgtatgcgctgt aacgcccggaacgcctccgaggccgagcgctgccgcaagtgcggctacaccaatctccgt ccgaaggcgaccgagcgccgcgccgcgtaa

DBGET integrated database retrieval system